PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g15470.1
Common NameLR48_Vigan10g255100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ZF-HD
Protein Properties Length: 89aa    MW: 9574.82 Da    PI: 8.5036
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g15470.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.23.6e-321975360
     ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                    +v+Y eC+kNhAa++Gg+avDGC+Efm+s g egt+aal+CaACgCHRnFH+r+ve+e
  Vang02g15470.1 19 SVKYGECQKNHAANVGGYAVDGCREFMAS-GGEGTTAALTCAACGCHRNFHKRQVETE 75
                    699*************************9.8889*******************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.7E-302072IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.8E-262171IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-172185IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3622271IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MRKRQVVVRR EEPQRSVRSV KYGECQKNHA ANVGGYAVDG CREFMASGGE GTTAALTCAA  60
CGCHRNFHKR QVETEVVCEC SSPPSIGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-147AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508009.13e-59PREDICTED: mini zinc finger protein 2-like
SwissprotQ9LJW53e-42MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A0L9VPI33e-59A0A0L9VPI3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T8H53e-59A0A0S3T8H5_PHAAN; Uncharacterized protein
STRINGGLYMA13G05380.29e-50(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-25mini zinc finger 2
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]